Skip Navigation

JNCI Journal of the National Cancer Institute 2002 94(4):267-273; doi:10.1093/jnci/94.4.267
© 2002 by Oxford University Press
This Article
Right arrow Abstract Freely available
Right arrow FREE Full Text (PDF) Freely available
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Add to My Personal Archive
Right arrow Download to citation manager
Right arrow Request Permissions
Google Scholar
Right arrow Articles by Del Valle, L.
Right arrow Articles by Khalili, K.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Del Valle, L.
Right arrow Articles by Khalili, K.
Social Bookmarking
 Add to CiteULike   Add to Connotea   Add to Del.icio.us  
What's this?

Journal of the National Cancer Institute, Vol. 94, No. 4, 267-273, February 20, 2002
© 2002 Oxford University Press


ARTICLE

Expression of Human Neurotropic Polyomavirus JCV Late Gene Product Agnoprotein in Human Medulloblastoma

Luis Del Valle, Jennifer Gordon, Sahnila Enam, Serena Delbue, Sidney Croul, Selvajothi Abraham, Sujatha Radhakrishnan, Martha Assimakopoulou, Christos D. Katsetos, Kamel Khalili

Affiliations of authors: L. Del Valle, J. Gordon, S. Enam, S. Delbue, S. Croul, S. Abraham, S. Radhakrishnan, M. Assimakopoulou, K. Khalili, Center for Neurovirology and Cancer Biology, College of Science and Technology, Temple University, Philadelphia, PA; C. D. Katsetos, Department of Pediatrics, MCP-Hahnemann University, and Department of Pediatrics and Pathology and Laboratory Medicine, St. Christopher's Hospital for Children, Philadelphia.

Correspondence to: Kamel Khalili, Ph.D., Center for Neurovirology and Cancer Biology, College of Science and Technology, Temple University, 1900 North 12th St., 015-96, Rm. 203, Philadelphia, PA 19122 (e-mail: kkhalili{at}astro.temple.edu).


    ABSTRACT
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
Background: The human neurotropic polyomavirus, JCV, contains an open reading frame within the late region of the viral genome that encodes a 71-amino-acid protein, agnoprotein. Because accumulating evidence supports an association between JCV infection and human brain tumors, including medulloblastomas, we assessed the presence of JCV Agno gene sequences and the expression of agnoprotein in a series of 20 well-characterized medulloblastomas. Methods: Formalin-fixed, paraffin-embedded tumor tissue samples were used for Agno gene amplification and for immunohistochemical analysis. Adjacent sections were stained with an antibody to agnoprotein and with antibodies to cellular structural and regulatory proteins, including the JCV early gene product, T antigen. Results: Analysis of amplified DNA from paraffin-embedded samples revealed the presence of the Agno gene in 11 (69%) of 16 samples. Immunohistochemical analysis showed cytoplasmic localization and widespread distribution of agnoprotein in the neoplastic cells in 11 (55%) of 20 samples. The JCV early gene product, T antigen, was present in the nucleus of some, but not all, of the neoplastic cells. Some medulloblastoma samples that expressed agnoprotein had no sign of T-antigen expression. p53 was detected in only six of the 11 tumors in which agnoprotein was expressed. None of the 20 samples showed expression of the viral late capsid proteins, ruling out productive infection of the tumor cells with JCV. Conclusions: Our data provide evidence that the JCV late gene encoding the auxiliary agnoprotein is expressed in tumor cells. The finding of agnoprotein expression in the absence of T-antigen expression suggests a potential role for agnoprotein in pathways involved in the development of JCV-associated medulloblastomas.



    INTRODUCTION
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
The human polyomavirus JCV has received special attention because of its established role in the fatal demyelinating disease, progressive multifocal leukoencephalopathy (PML), which is frequently seen in patients with acquired immunodeficiency syndrome (AIDS) (1,2). Similar to other polyomaviruses, the genome of JCV is composed of a double-stranded, circular, closed DNA, which contains coding sequences for the viral early protein T antigen and the late capsid proteins VP1, VP2, and VP3 as well as the auxiliary agnoprotein (3,4). Much attention has been paid to the multifunctional viral protein T antigen, whose expression is pivotal for initiation of the viral lytic cycle through stimulation of the DNA replication and late gene expression (5). Furthermore, in the absence of viral lytic infection, the production of the T antigen in an in vitro system results in transformation of neural cells (6–8); moreover, in several in vivo animal models, T antigen induces the formation of a broad range of neural-origin tumors [for review, see (9)]. For example, when JCV is inoculated intracerebrally in experimental animals, it induces a broad range of tumors, including medulloblastomas, astrocytomas, and glioblastomas (10–12). Finally, several transgenic mouse lines containing the sequences for the T antigen under the control of the JCV promoter have developed tumors of neuroectodermal origin (13–15). The oncogenic potential of the T antigen is due, at least in part, to the ability of this protein to interact with and functionally inactivate several cellular tumor suppressor proteins, including p53 and pRb, which are involved in the control of cell growth and proliferation (16,17).

The biologic role of the auxiliary agnoprotein in the viral lytic infection cycle and its effect on various cellular regulatory pathways remain unknown. The most recent studies from our laboratory (18), however, demonstrate that the interaction of the JCV T antigen with agnoprotein may have a functional consequence on the ability of the T antigen to enhance transcription and replication of the viral genome. We investigated the presence of the Agno gene and the expression of the agnoprotein in human medulloblastomas and in several PML samples.


    MATERIALS AND METHODS
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
Clinical Samples

A total of 20 formalin-fixed, paraffin-embedded biopsy and autopsy samples of medulloblastomas were collected from the pathology archives of St. Christopher's Hospital for Children and from MCP-Hahnemann University, in Philadelphia, PA. Three samples of PML cases (two from human immunodeficiency virus-1 [HIV-1]-infected patients with AIDS and one from a patient without AIDS) were obtained from the Manhattan HIV-1 Brain Bank at Mount Sinai Medical Center in New York, NY. All of the samples were obtained in accordance with the guidelines from the institutional review boards of the participating universities.

Development of Anti-agnoprotein Antibody

Three peptides, as shown below, that correspond to various regions of the agnoprotein were synthesized by Macromolecular Resources (Colorado State University, Fort Collins, CO). The sequences of the peptides are as follows: JAG-38—MVLRQLSRKASVKVSKTWSGTKKRAQRILIFLLEFLLDC; JAG-36—LLDFCTGEDSVDGKKRQRHSGLTEQTYSALPEPKATC; and JAG-34—GTKKRAQRILIFLLEFLLDFCTGEDSVDGKKRQRC.

Approximately 2 mg of each peptide was pooled and used for injection of rabbits (Lampire Biological Laboratories, Pipersville, PA). The final sera were obtained 98 days after the initial injection and used in these studies.

Infection and Western Blot Analysis

SVG-A cells, which were subcloned from the parental line SVG that was derived from human primary fetal glial cells transformed with origin-defective simian virus 40 (SV40), were provided by Dr. Walter Atwood (Brown University, Providence, RI) for use in infection experiments. These cells express the SV40 T antigen but do not express the viral late genes. Approximately 5 x 106 SVG-A cells were infected with approximately 500 hemagglutination units of the Mad-4 strain of JCV in Dulbecco's modified Eagle medium containing fetal calf serum. After 4 hours, fetal calf serum was added to the culture medium (final concentration = 10%), and the cells were harvested 5, 10, and 15 days after infection. The protein extracts from the uninfected or infected cells (50 µg) were analyzed directly by western blot or were first reacted with preimmune or anti-agnoprotein antibody, and the immune complex was analyzed by western blot according to the standard procedures described previously (18).

Histologic and Immunohistochemical Analyses

Formalin-fixed, paraffin-embedded tissue was sectioned at 4-µm thickness and stained with hematoxylin–eosin for histologic studies. The classification of the tumors was based on the latest World Health Organization Classification of Tumors (19). Immunohistochemical analysis was performed with the use of an avidin–biotin–peroxidase complex system according to the manufacturer's instructions (Vectastain Elite ABC Peroxidase Kit; Vector Laboratories Inc., Burlingame, CA). The protocol includes deparaffinization in xylenes and rehydration of the tissue through descending grades of alcohols up to water. Nonenzymatic antigen retrieval was performed by heating the sections to 95 °C in 0.01 M sodium citrate buffer (pH 6.0) for 40 minutes in a vacuum oven. After cooling for 30 minutes, the slides were rinsed in phosphate-buffered saline (PBS) and incubated in methanol–3% H2O2 for 20 minutes to quench the endogenous peroxidase. The sections were then rinsed with PBS and blocked with 5% normal horse or goat serum in 0.1% PBS–bovine serum albumin for 2 hours at room temperature. Primary antibodies, including those reactive against viral proteins and cellular markers, were incubated overnight at room temperature in a humidified chamber. Primary antibodies used in this study included rabbit polyclonal antibody against agnoprotein (1 : 500 dilution), rabbit polyclonal antibody against JCV capsid proteins (1 : 1000; provided by Dr. Walter Atwood), mouse monoclonal antibody for the detection of SV40 T antigen that cross-reacts with JCV T antigen (clone pAb416, 1 : 100 dilution; Oncogene Science, Boston, MA), mouse monoclonal antibody against p53 (clone DO-7, 1 : 100 dilution; Dako, Carpinteria, CA), mouse monoclonal antibody for GFAP (i.e., glial fibrillary acidic protein; clone 62F, 1 : 100 dilution; Dako), and mouse monoclonal antibody against the 38-kd form of synaptophysin (clone MAB332, 1 : 500 dilution; Chemicon International, Temecula, CA). After the sections were rinsed in PBS, biotinylated anti-mouse or anti-rabbit secondary antibodies were incubated for 1 hour at room temperature and rinsed in PBS. The tissue was subsequently incubated with avidin–biotin–peroxidase complexes for 1 hour at room temperature. Finally, the sections were developed with a diaminobenzidine substrate counterstained with hematoxylin and mounted under coverslips with Permount (Fisher, Pittsburgh, PA).

DNA Extraction and Polymerase Chain Reaction Amplification

DNA was prepared from 10 sections of 10-µm thickness from each of the tissue samples by use of the QIAamp DNA Tissue Kit, according to the manufacturer's instructions (Qiagen, Valencia, CA).

For amplification of the Agno gene, a set of primers that specifically recognize JCV Agno gene was used, and the amplified DNA was hybridized with the use of JCV-specific DNA probe as depicted in Fig. 1Go. Southern blot analysis was performed according to a procedure that has been established in our laboratory and described previously (20,21). Amplification of the JCV early sequence was performed with the use of a set of primers that recognize the N-terminal region of the JCV T antigen, and hybridization was performed with the use of JCV-specific probes as described earlier (21).




View larger version (98K):
[in this window]
[in a new window]
 
Fig. 1. Polymerase chain reaction (PCR) amplification of Agno gene sequences in medulloblastomas and detection of agnoprotein during the course of infection. Panel A, left: schematic representation of the JC virus genome and the position of the oligonucleotide primers used for detection of Agno gene DNA sequences. Numbers in the inner circle represent the map positions with 0 as the EcoRI site (3). The positions of the viral early protein, T antigen (T), the late capsid proteins VP1, VP2, and VP3, and the agnoprotein (Agno), as well as the viral control region are shown. Panel A, right (top): PCR product was analyzed by Southern blot. Number above each lane represents the case number that appears in Table 1Go. bp = base pair; NC = negative control; PC = positive control. Panel A, right (bottom): Nucleotide composition of the amplified DNA is illustrated. The position of the PCR primers is underlined, and the nucleotide sequence corresponding to the probe used for Southern blotting is shown with the nucleotides in bold. Panel B: Approximately 50 µg of protein extract from uninfected (lane 1) or JCV-infected SVG-A cells at various times, as indicated above the lanes (lanes 2–4), was fractionated by sodium dodecyl sulfate–polyacrylamide gel electrophoresis; after transfer to nylon membrane, the transblot was treated with anti-agnoprotein antibody (1 : 500 dilution). For immunoprecipitation experiments (lanes 5–7), 200 µg of protein extract from infected (lanes 5 and 6) or uninfected cells were treated with preimmune (lane 5) or anti-agnoprotein (lanes 6 and 7) antibody, and the immunocomplex was analyzed by western blot analysis as described above. The position of the agnoprotein is depicted by a bracket.

 

    RESULTS
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
The association of JCV with human brain tumors in general and with embryonal neuroepithelial tumors of the cerebellum in particular prompted us to investigate the expression of the viral late gene product, agnoprotein, in a series of well-characterized cerebellar medulloblastomas. For these experiments, we selected 20 surgically excised and autopsy tumor samples obtained from the pathology archives of St. Christopher's Hospital for Children and MCP-Hahnemann University. These samples represented the different histologic varieties, i.e., classical (nine samples), desmoplastic medulloblastoma (seven samples), and medulloblastoma with neuroblastic differentiation (four samples). They were obtained from patients who were between the ages of 3 and 18 years. In addition, three archival autopsy samples from PML patients, either AIDS-related (two samples) or non-AIDS-related (one sample), were included in this study.

In the first series of experiments, a pair of primers that specifically recognize JCV DNA corresponding to the Agno gene was used for gene amplification, followed by Southern blot analysis. Fig. 1Go, A, illustrates the position of the Agno gene in the JCV genome (left panel), a representative gene amplification/Southern blot (top, right panel), and the DNA sequence highlighting the Agno gene sequence. Results from DNA analysis revealed that 11 (69%) of the 16 samples had sequences corresponding to the Agno gene (Table 1Go). It is interesting that some, but not all, of the tumors positive for the Agno gene also contained DNA sequences corresponding to the early gene of JCV, T antigen (data not shown). Examination of the T-antigen sequences was performed according to our earlier procedure using a set of primers that recognize the N-terminal region of the JCV T antigen followed by hybridization using a JCV-specific DNA probe (21). Seven (44%) of 16 samples that were examined contained DNA sequences corresponding to the T antigen and the Agno gene, whereas three were positive for the T antigen and negative for the Agno gene, and four contained the Agno gene but not the T antigen.


View this table:
[in this window]
[in a new window]
 
Table 1. Immunohistochemical and polymerase chain reation (PCR)–Southern blot analyses of medulloblastoma and progressive multifocal leukoencephalopathy (PML) samples*
 
To investigate the expression of the auxiliary agnoprotein, we developed a specific polyclonal antibody that recognizes the JCV agnoprotein. Synthetic peptides derived from the various regions of JCV agnoprotein (as described in the "Materials and Methods" section) were used for the development of a polyclonal antibody. To examine the ability of antisera to recognize JCV agnoprotein, we performed western blot analysis using protein extracts from SVG-A cells infected with JCV Mad-4 at various times after infection. As shown in Fig. 1Go, B, an approximately 8-kd protein, corresponding to the 71-amino-acid JCV agnoprotein, was detected 5 days after infection, and its levels increased 10 and 15 days after infection. We obtained no band corresponding to agnoprotein in protein extracts from uninfected cells (lane 1 in Fig. 1Go, B); in an immunoprecipitation experiment, the preimmune sera failed to precipitate any protein corresponding to the agnoprotein from the infected cell extract (lane 5 in Fig. 1Go, B). Furthermore, the anti-agnoprotein antibody showed no immunoreactivity with proteins from uninfected cells in the immunoprecipitation assay. These results confirmed the specificity of our antibody in recognizing agnoprotein.

In the next series of experiments, to examine the expression of agnoprotein in tumor cells and to determine its subcellular localization, we conducted an immunohistochemical analysis on the samples. Fig. 2Go illustrates a desmoplastic medulloblastoma containing small, polar cells with neuritic processes (panel A), which exhibited a strong immunoreactivity for synaptophysin (panel B). Nine of the tumor samples showed nuclear immunoreactivity when they were tested with a monoclonal antibody against the T antigen, corroborating our earlier observations on the detection of the T antigen in human medulloblastomas. Immunoreactivity for the T antigen was observed in the nuclei of neoplastic cells in nine samples. By immunohistochemistry, p53 (a protein that, upon association with the T antigen, remains nonfunctional but in a stable form) was localized in the nuclei of the neoplastic cells, which corresponded to the same cellular compartment in which T antigen was detected (Fig. 2Go, C and D, respectively). Again, agnoprotein was found in cytoplasmic perinuclear regions of the neoplastic cells (Fig. 2Go, E). No evidence for the production of the viral late protein VP1 was observed in the neoplastic cells (Fig. 2Go, F). Examination of brain samples from patients with PML revealed an extremely weak immunoreactivity of the infected cells with an anti-T-antigen antibody, which is a typical feature of cells under lytic infection by polyomavirus due to the fact that viral early gene expression is reduced during later stages of infection when the capsid proteins are expressed (Fig. 2Go, G). In contrast, robust cytoplasmic perinuclear and nuclear localizations were detected, respectively, for agnoprotein and VP1 in JCV-infected, enlarged oligodendrocytes (Fig. 2Go, H and I, respectively). Table 1Go summarizes the results from immunohistochemical and polymerase chain reaction analyses of medulloblastoma and PML samples. Immunohistochemical analysis showed cytoplasmic localization and widespread distribution of agnoprotein in the neoplastic cells in 11 (55%) of 20 samples.



View larger version (107K):
[in this window]
[in a new window]
 
Fig. 2. Morphologic analysis of medulloblastomas and progressive multifocal leukoencephalopathy (PML) samples. Panel A: Hematoxylin– eosin staining of a desmoplastic medulloblastoma illustrating small, polar cells with growth cone-like processes. Panel B: immunohistochemistry for synaptophysin localized in clusters of tumor cells, confirming the predominantly neuronal phenotype of the tumor. Panel C: immunohistochemical localization of p53 in the nuclei of neoplastic cells. Panel D: Localization of T antigen with the use of a monoclonal anti-T-antigen antibody (pAb416) demonstrates the presence of the viral early protein in nuclei of some tumor cells. Panel E: The viral agnoprotein was detected with the use of polyclonal antibody that is developed in our laboratory. Agnoprotein is present in the cytoplasm of the neoplastic cells in a perinuclear fashion. Panel F: Immunohistochemistry using an antibody against the capsid protein VP1 shows no immunoreactivity in the tumor cells. Panel G: Immunohistochemistry using anti-T-antigen antibody shows no staining in the area of a demyelination plaque of a PML case. Panel H: Immunohistochemistry against agnoprotein shows intense immunoreactivity in the cytoplasm of a JCV-infected oligodendrocyte. Panel I: detection of the JCV capsid protein VP1 in the nuclei of infected oligodendrocytes from a case of PML. All panels: original magnification x1000.

 
Double labeling of the tumor samples with antibodies to the T antigen and the agnoprotein showed differential localization of the T antigen in the nuclei and agnoprotein in the cytoplasmic perinuclear compartment within single neoplastic cells. Fig. 3Go, A and B, illustrates a representative field of a classical medulloblastoma after double-labeled immunohistochemistry for the agnoprotein and T antigen. In a PML case, co-immunostaining of the brain also showed differential localization of the agnoprotein in the cytoplasmic perinuclear region and VP1 in the nuclei of an infected oligodendrocyte (Fig. 3Go, C and D, respectively).



View larger version (114K):
[in this window]
[in a new window]
 
Fig. 3. Double labeling of medulloblastomas and progressive multifocal leukoencephalopathy (PML) samples for detection of JCV proteins. Panels A and B: Double-labeling immunohistochemistry with two primary antibodies demonstrates the presence of T antigen in the nuclei (red) and of agnoprotein in the cytoplasm (brown) of the same neoplastic cells in a case of a classic medulloblastoma (original magnification x1000). Panels C and D: presence of agnoprotein in the cytoplasm (brown) and of the capsid protein VP1 in the nuclei (red) of infected oligodendrocytes within a demyelination plaque of a PML sample (original magnification x1000).

 

    DISCUSSION
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
For the first time, to our knowledge, these data provide evidence that the polyomavirus late gene product agnoprotein is detected in pediatric brain tumors, more specifically in medulloblastomas. Medulloblastomas are the second most common primary brain tumor in children (after astrocytomas), accounting for 20% of all childhood brain tumors, and represent the most frequent malignant tumor of the brain in children (22–24). The majority of childhood medulloblastomas originate in the cerebellar vermis, presumably from the transformation of immature neuroepithelial cells of the external granular layer (25). In adolescents and young adults, the tumors have a predilection for the cerebellar hemispheres and may exhibit features of the desmoplastic variant (25,26). Histologically, medulloblastomas are composed of numerous sheaths of poorly differentiated, blue cells with scant cytoplasm. Features of early, albeit incomplete, neuronal differentiation are the neuroblastic rosettes and the areas of neoplastic neuritogenesis ("pale islands") that typify the desmoplastic medulloblastomas. Divergent glial differentiation is rare (25).

The etiology and pathogenesis of medulloblastomas are not fully understood. Risk factors associated with the development of medulloblastomas are radiation exposure, certain genetic heritable syndromes, which include neurofibromatosis type I, Turcot's syndrome (27,28), and the nevoid basal cell carcinoma syndrome or Gorlin's syndrome (29,30). Although other genetic alterations, including p53 germline mutations (31,32), unbalanced translocations, deletions and duplications of chromosomes 1 and 10q, and isochromosome 17q, have been detected in approximately 50% of the cases (33,34), the majority of these malignant embryonal tumors are sporadic and their etiology remains unknown.

The development of medulloblastoma in transgenic mice containing the JCV early genome provided the rationale for earlier efforts by our group and other groups (35–37) to investigate the association of JCV with human medulloblastoma. In that setting, the major emphasis was on the viral early gene and on the expression of the T antigen in tumor cells. Detection of the JCV DNA sequence in surprisingly high numbers of cases prompted us to increase the scope of the study and to examine the expression of viral proteins that are encoded by the late regions in human medulloblastoma. Although we found no evidence for the expression of the late capsid proteins VP1, VP2, and VP3 (data not shown) in these samples, results from immunostaining showed the detection of agnoprotein in the tumor cells. It is interesting that, in some tumor samples, DNA sequences corresponding to the Agno gene and the expression of agnoprotein were found in the absence of the JCV early gene sequence and its oncogenic product, T antigen. This observation may imply a role for agnoprotein in the development of medulloblastoma.

Infection with JCV occurs in early childhood, with 65% of the population infected by 14 years of age (38), most likely through spread from parent to child (39). Reviews (40) have discussed a role for B lymphocytes in the circulation of the virus throughout the body because virus has been detected in B cells from healthy individuals. Although the specific mechanism by which JCV may enter the brain is unknown, one can envision a scenario in which initial infection with JCV in children results in virus entry into the brain by the infected B cells during cerebellar development, resulting in infection of the cells that are thought to give rise to medulloblastoma.

The detection of agnoprotein in the perinuclear cytoplasmic region of both tumor cells as well as in infected oligodendrocytes from patients with PML indicates that subcellular localization of the protein remains unchanged during the course of these two distinct pathologic events. Although the function of agnoprotein remains to be investigated, one may envision a role for this protein in enhancing various cellular processes, such as transcription and replication, which are essential for the viral lytic cycle. In the absence of viral lytic infection, stimulation of cellular events by agnoprotein may lead to rapid and perhaps uncontrolled growth of the cells and to the development of neoplasm. Indeed, not mutually exclusive, one may also assume an anti-apoptotic role for agnoprotein, which is beneficial for virus replication in the infection pathway and the maintenance of tumor cells and growth in the neoplastic pathway.

The detection of JCV in human medulloblastoma may indicate a role for the virus in a subset of medulloblastoma. We have demonstrated viral DNA sequences in tumors that do not express T antigen or agnoprotein, as well as the presence of only one of the viral proteins. Chromosomal instability has been attributed to the T antigen leading to loss of viral genes during the course of tumorigenesis, which can explain why the whole genome of JCV may not be detected in every tumor sample (41). In addition, studies have indicated that the T antigen may not be required to maintain a transformed phenotype, leading to loss of its expression (42). Thus, the absence of the T antigen in some tumor cells with or without agnoprotein is not surprising. Cooperation between the agnoprotein and the T antigen in early stages of tumor development, however, remains to be investigated.


    NOTES
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 
Present address: M. Assimakopoulou, Department of Anatomy, University of Patras School of Medicine, Greece.

Supported by Public Health Service grants NS36466 and NS30916 (to K. Khalili) from the National Institute of Neurological Disorders and Stroke, National Institutes of Health, Department of Health and Human Services.

We thank Dr. Susan Morgello (Director of the Manhattan HIV Brain Bank [R-24-MH-59724] at Mount Sinai School of Medicine, New York, NY) for providing the cases of progressive multifocal leukoencephalopathy and Dr. Walter Atwood (Brown University, Providence, RI) for providing antibodies and the SVG-A cell line. We express our gratitude to Dr. Mahmut Safak (Center for Neurovirology and Cancer Virology, Temple University, Philadelphia, PA) for his time in designing the peptides that were used for peptide synthesis and antibody production. We also thank the present and past members of the Center for Neurovirology and Cancer Biology for their support, insightful discussion, and sharing of ideas and reagents. We are grateful to Cynthia Schriver of the Center for Neurovirology and Cancer Biology for her editorial assistance and preparation of this manuscript.


    REFERENCES
 Top
 Abstract
 Introduction
 Materials and Methods
 Results
 Discussion
 References
 

1 Berger JR, Concha M. Progressive multifocal leukoencephalopathy: the evolution of a disease once considered rare. J Neurovirol 1995;1:5–18.[ISI][Medline]

2 Major EO, Amemiya K, Tornatore CS, Houff SA, Berger JR. Pathogenesis and molecular biology of progressive multifocal leukoencephalopathy, the JC virus-induced demyelinating disease of the human brain. Clin Microbiol Rev 1992;5:49–73.[Abstract/Free Full Text]

3 Frisque RJ, Bream GL, Cannella MT. Human polyomavirus JC virus genome. J Virol 1984;51:458–69.[Abstract/Free Full Text]

4 Raj GV, Khalili K. Transcriptional regulation: lessons from the human neurotropic polyomavirus, JCV. Virology 1995;213:283–91.[CrossRef][ISI][Medline]

5 Shah KV. Polyomaviruses. In: Fields BN, Knipe DM, editors. Fields virology. New York (NY): Raven Press; 1990. p. 1609–24.

6 Bollag B, Chuke WF, Frisque RJ. Hybrid genomes of the polyomaviruses JC virus, BK virus, and simian virus 40: identification of sequences important for efficient transformation. J Virol 1989;63:863–72.[Abstract/Free Full Text]

7 Mandl C, Walker DL, Frisque RJ. Derivation and characterization of POJ cells, transformed human fetal glial cells that retain their permissivity for JC virus. J Virol 1987;61:755–63.[Abstract/Free Full Text]

8 Manfredi JJ, Prives C. The transforming activity of simian virus 40 large tumor antigen. Biochim Biophys Acta 1994;1198:65–83.[Medline]

9 Gallia GL, Gordon J, Khalili K. Tumor pathogenesis of human neurotropic JC virus in the CNS. J Neurovirol 1998;4:175–81.[ISI][Medline]

10 London WT, Houff SA, Madden DL, Fuccillo DA, Gravell M, Wallen WC, et al. Brain tumors in owl monkeys inoculated with a human polyomavirus (JCV virus). Science 1978;201:1246–9.[Abstract/Free Full Text]

11 Walker DL, Padgett BL, ZuRhein GM, Albert AE, Marsh RF. Human papovavirus (JC): induction of brain tumors in hamsters. Science 1973;181:674–6.[Abstract/Free Full Text]

12 Zu Rhein GM, Varakis JN. Perinatal induction of medulloblastomas in Syrian golden hamsters by a human polyoma virus (JC). Natl Cancer Inst Monogr 1979;51:205–8.

13 Franks RR, Rencic A, Gordon J, Zoltick PW, Curtis M, Knobler RL, et al. Formation of undifferentiated mesenteric tumors in transgenic mice expressing human neurotropic polyomavirus early protein. Oncogene 1996;12:2573–8.[ISI][Medline]

14 Gordon J, Del Valle L, Otte J, Khalili K. Pituitary neoplasia induced by expression of human neurotropic virus JCV, early genome in transgenic mice. Oncogene 2000;19:4840–6.[CrossRef][ISI][Medline]

15 Small JA, Khoury G, Jay G, Howley PM, Scangos GA. Early regions of JC virus and BK virus induce distinct and tissue-specific tumors in transgenic mice. Proc Natl Acad Sci U S A 1986;83:8288–92.[Abstract/Free Full Text]

16 Dyson N, Bernards R, Friend SH, Gooding LR, Hassell JA, Major EO, et al. Large T antigens of many polyomaviruses are able to form complexes with the retinoblastoma protein. J Virol 1990;64:1353–6.[Abstract/Free Full Text]

17 Ludlow JW. Interactions between SV40 large-tumor antigen and the growth suppressor proteins pRB and p53. FASEB J 1993;7:866–71.[Abstract]

18 Safak M, Barrucco R, Darbinyan A, Okada Y, Nagashima K, Khalili K. Interaction of JC virus agno protein with T antigen modulates transcription and replication of the viral genome in glial cells. J Virol 2001;75:1476–86.[Abstract/Free Full Text]

19 Kleihues P, Cavenee WK. World Health Organization Classification of Tumours. Pathology and genetics. Tumours of the nervous systems. Lyon (France): IARC Press; 2000.

20 Del Valle L, Azizi SA, Krynska B, Enam S, Croul SE, Khalili K. Reactivation of human neurotropic JC virus expressing oncogenic protein in a recurrent glioblastoma multiforme. Ann Neurol 2000;48:932–6.[CrossRef][ISI][Medline]

21 Del Valle L, Gordon J, Assimakopoulou M, Enam S, Geddes JF, Varakis JN, et al. Detection of JC virus DNA sequences and expression of the viral regulatory protein T-antigen in tumors of the central nervous system. Cancer Res 2001;61:4287–93.[Abstract/Free Full Text]

22 Central Brain Tumor Registry of the United States. Primary brain tumors in the United States. Statistical Report 1992–1997 CBTRUS; 2000.

23 Heltseth A, Mork SJ. Neoplasms of the central nervous system in Norway. III. Epidemiological characteristics of intracranial gliomas according to histology. APMIS 1989;97:547–55.[ISI][Medline]

24 Stevens MC, Cameron AH, Muir KR, Parkes SE, Reid H, Whitwell H. Descriptive epidemiology of primary central nervous system tumours in children: a population based study. Clin Oncol (R Coll Radiol) 1991;3:323–9.

25 Katsetos CD, Burger PC. Medulloblastoma. Semin Diagn Pathol 1994;11:85–97.[ISI][Medline]

26 Hubbard JL, Scheithauer BW, Kispert DB, Carpenter SM, Wick MR, Laws ER Jr. Adult cerebellar medulloblastomas: the pathological, radiographic, and clinical disease spectrum. J Neurosurg 1989;70:536–44.[ISI][Medline]

27 Hamilton SR, Liu B, Parsons RE, Papadopoulos N, Jen J, Powell SM, et al. The molecular basis of Turcot's syndrome. N Engl J Med 1995;332:839–47.[Abstract/Free Full Text]

28 Paraf F, Jothy S, Van Meir EG. Brain tumor–polyposis syndrome: two genetic diseases? J Clin Oncol 1997;15:2744–58.[Abstract/Free Full Text]

29 Evans DG, Farndon PA, Burnell LD, Gattamaneri HR, Birch JM. The incidence of Gorlin syndrome in 173 consecutive cases of medulloblastoma. Br J Cancer 1991;64:959–61.[ISI][Medline]

30 Lacombe D, Chateil JF, Fontan D, Battin J. Medulloblastoma in the nevoid basal-cell carcinoma syndrome: case reports and review of the literature. Genet Couns 1990;1:273–7.[Medline]

31 Ohgaki H, Eibl RH, Wiestler OD, Yasargil MG, Newcomb EW, Kleihues P. p53 mutations in nonastrocytic human brain tumors. Cancer Res 1991;51:6202–5.[Abstract/Free Full Text]

32 Ohgaki H, Eibl RH, Schwab M, Reichel MB, Mariani L, Gehring M, et al. Mutations of the p53 tumor suppressor gene in neoplasms of the human nervous system. Mol Carcinog 1993;8:74–80.[ISI][Medline]

33 Bigner SH, Mark J, Friedman HS, Biegel JA, Bigner DD. Structural chromosomal abnormalities in human medulloblastoma. Cancer Genet Cytogenet 1988;30:91–101.[CrossRef][ISI][Medline]

34 Griffin CA, Hawkins AL, Packer RJ, Rorke LB, Emanuel BS. Chromosome abnormalities in pediatric brain tumors. Cancer Res 1988;48:175–80.[Abstract/Free Full Text]

35 Caldarelli-Stefano R, Boldorini R, Monga G, Meraviglia E, Zorini EO, Ferrante P. JC virus in human glial-derived tumors. Hum Pathol 2000;31:394–5.[CrossRef][ISI][Medline]

36 Khalili K, Krynska B, Del Valle L, Katsetos CD, Croul S. Medulloblastomas and the human neurotropic polyomavirus JC virus [letter]. Lancet 1999;353:1152–3.[ISI][Medline]

37 Krynska B, Del Valle L, Croul SE, Gordon J, Katsetos CD, Carbone M, et al. Detection of human neurotropic JC virus DNA sequence and expression of the viral oncogenic protein in pediatric medulloblastomas. Proc Natl Acad Sci U S A 1999;96:11519–24.[Abstract/Free Full Text]

38 Walker DL, Padgett BL. The epidemiology of human polyomaviruses. In: Sever JL, Madden DC, editors. Polyomaviruses and human neurological diseases. New York (NY): Alan R. Liss; 1983. p. 99–106.

39 Kunitake T, Kitamura T, Guo J, Taguchi F, Kawabe K, Yogo Y. Parent-to-child transmission is relatively common in the spread of the human polyomavirus JC virus. J Clin Microbiol 1995;33:1448–51.[Abstract]

40 Gallia GL, Houff SA, Major EO, Khalili K. Review: JC virus infection of lymphocytes—revisited. J Infect Dis 1997;176:1603–9.[ISI][Medline]

41 Kappler R, Pietsch T, Weggen S, Weistler OD, Scherthan H. Chromosomal imbalances and DNA amplifications in SV40 large T antigen-induced primitive neuroectodermal tumor cell lines of the rat. Carcinogenesis 1999;20:1433–8.[Abstract/Free Full Text]

42 Woods C, LeFeuvre C, Stewart N, Bacchetti S. Induction of genomic instability in SV40 transformed human cells: sufficiency of the N-terminal 147 animo acids of large T antigen and role of pRB and p53. Oncogene 1994;10:2943–50.

Manuscript received July 25, 2001; revised October 12, 2001; accepted December 18, 2001.


Add to CiteULike CiteULike   Add to Connotea Connotea   Add to Del.icio.us Del.icio.us    What's this?


This article has been cited by other articles:


Home page
J. Virol.Home page
N. Merabova, D. Kaniowska, R. Kaminski, S. L. Deshmane, M. K. White, S. Amini, A. Darbinyan, and K. Khalili
JC Virus Agnoprotein Inhibits In Vitro Differentiation of Oligodendrocytes and Promotes Apoptosis
J. Virol., February 1, 2008; 82(3): 1558 - 1569.
[Abstract] [Full Text] [PDF]


Home page
NeurologyHome page
A. Altieri, F. Castro, J. L. Bermejo, and K. Hemminki
Association between number of siblings and nervous system tumors suggests an infectious etiology
Neurology, December 12, 2006; 67(11): 1979 - 1983.
[Abstract] [Full Text] [PDF]


Home page
J. Virol.Home page
D. Kaniowska, R. Kaminski, S. Amini, S. Radhakrishnan, J. Rappaport, E. Johnson, K. Khalili, L. Del Valle, and A. Darbinyan
Cross-Interaction between JC Virus Agnoprotein and Human Immunodeficiency Virus Type 1 (HIV-1) Tat Modulates Transcription of the HIV-1 Long Terminal Repeat in Glial Cells.
J. Virol., September 1, 2006; 80(18): 9288 - 9299.
[Abstract] [Full Text] [PDF]


Home page
GutHome page
C R Boland, M G Luciani, C Gasche, and A Goel
INFECTION, INFLAMMATION, AND GASTROINTESTINAL CANCER
Gut, September 1, 2005; 54(9): 1321 - 1331.
[Full Text] [PDF]


Home page
J. Virol.Home page
A. Darbinyan, K. M. Siddiqui, D. Slonina, N. Darbinian, S. Amini, M. K. White, and K. Khalili
Role of JC Virus Agnoprotein in DNA Repair
J. Virol., August 15, 2004; 78(16): 8593 - 8600.
[Abstract] [Full Text] [PDF]


Home page
Am J EpidemiolHome page
F. Menegaux, A. F. Olshan, J. P. Neglia, B. H. Pollock, and M. L. Bondy
Day Care, Childhood Infections, and Risk of Neuroblastoma
Am. J. Epidemiol., May 1, 2004; 159(9): 843 - 851.
[Abstract] [Full Text] [PDF]


Home page
Cancer Epidemiol. Biomarkers Prev.Home page
P. A. Newcomb, A. C. Bush, G. L. Stoner, J. W. Lampe, J. D. Potter, and J. Bigler
No Evidence of an Association of JC Virus and Colon Neoplasia
Cancer Epidemiol. Biomarkers Prev., April 1, 2004; 13(4): 662 - 666.
[Abstract] [Full Text] [PDF]


Home page
J. Virol.Home page
L. Del Valle, S. Enam, C. Lara, J. Miklossy, K. Khalili, and J. Gordon
Primary Central Nervous System Lymphoma Expressing the Human Neurotropic Polyomavirus, JC Virus, Genome
J. Virol., April 1, 2004; 78(7): 3462 - 3469.
[Abstract] [Full Text] [PDF]


Home page
Cancer Res.Home page
W. Q. Yang, D. Senger, H. Muzik, Z. Q. Shi, D. Johnson, P. M. A. Brasher, N. B. Rewcastle, M. Hamilton, J. Rutka, J. Wolff, et al.
Reovirus Prolongs Survival and Reduces the Frequency of Spinal and Leptomeningeal Metastases from Medulloblastoma
Cancer Res., June 15, 2003; 63(12): 3162 - 3172.
[Abstract] [Full Text] [PDF]


Home page
J. Virol.Home page
R. L. Garcea and M. J. Imperiale
Simian Virus 40 Infection of Humans
J. Virol., May 1, 2003; 77(9): 5039 - 5045.
[Full Text] [PDF]


Home page
Cancer Res.Home page
S. Enam, L. Del Valle, C. Lara, D.-D. Gan, C. Ortiz-Hidalgo, J. P. Palazzo, and K. Khalili
Association of Human Polyomavirus JCV with Colon Cancer: Evidence for Interaction of Viral T-Antigen and {beta}-Catenin
Cancer Res., December 1, 2002; 62(23): 7093 - 7101.
[Abstract] [Full Text] [PDF]


Home page
JNCI J Natl Cancer InstHome page
H. A. Fine
Polyomavirus and Medulloblastoma: A Smoking Gun or Guilt By Association?
J Natl Cancer Inst, February 20, 2002; 94(4): 240 - 241.
[Full Text] [PDF]


This Article
Right arrow Abstract Freely available
Right arrow FREE Full Text (PDF) Freely available
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Add to My Personal Archive
Right arrow Download to citation manager
Right arrow Request Permissions
Google Scholar
Right arrow Articles by Del Valle, L.
Right arrow Articles by Khalili, K.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Del Valle, L.
Right arrow Articles by Khalili, K.
Social Bookmarking
 Add to CiteULike   Add to Connotea   Add to Del.icio.us  
What's this?